Tuesday, 19 November 2013

Competition Time - Teach-Discover-Treat 2014





Teach-Discover-Treat (TDT) is excited to announce our 2014 Competition. We have four exciting challenges that focus on developing and disseminating computational workflows for drug discovery of neglected diseases with a premium on reproducibility.

Three cash prizes - plus partial reimbursement of travel - will be awarded! Winners are required to present their work at the TDT Award symposium during the Fall 2014 ACS National Meeting in San Francisco, California.

Create and submit computational workflows that inspire drug discovery activities using freely available software tools. Detailed informationabout the 2014 Competition can be found here: http://www.TDTproject.org/2014-competition.html

Submissions deadline is February 3, 2014.

The TDT Steering Committee



Hanneke Jansen, Rommie Amaro, Jane Tseng, Wendy Cornell, Patrick Walters and Emilio Xavier Esposito




@TeachDiscoTreat

Thursday, 14 November 2013

New Drug Approvals 2013 - Pt. XIX - Ibrutinib (ImbruvicaTM)












ATC Code:


Wikipedia: Ibrutinib



On November 13, 2013, the FDA approved Ibrutinib (ImbruvicaTM) for the treatment of patients with mantle cell lymphoma (MCL) who have received at least one prior therapy. MCL is a subtype of B-cell lymphoma and accounts for 6% of non-Hodgkin's lymphoma cases. In an open-label, multi-center, single-arm trial of 111 previously treated patients, Ibrutinib showed a 65.8% response rate.







Ibrutinib is an irreversible inhibitor of the Tyrosine-protein kinase BTK (Uniprot:Q06187; ChEMBL:CHEMBL5251; canSAR target synopsis) and is the first approved targeted BTK inhibitor. It forms a covalent bond with a cysteine residue via a Michael acceptor mechanism, in the BTK active site, leading to inhibition of BTK enzymatic activity





Ibrutinib (ChEMBL:CHEMBL1873475; canSAR drug synopsis; also known as CRA-032765 and PCI-32765) has the formula C25H24N6O2 and a molecular weight 440.50. It is absorbed after oral administration with a median Tmax of 1-2 hours. After administration of 560 mg dose, the observed AUC is 953 ± 705 ng⋅h/mL. The apparent volume of distribution at steady state (Vd,ss/F) is approximately 10000 L and the half-life is 4 to 6 hours.



ImbruvicaTM is produced by Pharmacyclics, Inc.



The full Prescribing Information is here

New Drug Approvals 2013 - Pt. XVIII - Obinutuzumab (GazyvaTM)












ATC Code: L01XC15


Wikipedia: Obinutuzumab



On November 1, 2013 the FDA approved obinutuzumab (GazyvaTM) for use in combination with chlorambucil (a nitrogen mustard alkylating agent) for the treatment of patients with previously untreated chronic lymphocytic leukemia (CLL). CLL is the most common type of Leukaemia accounting for 35% of all reported Leukaemias (See CRUK CLL page). In a randomized three-arm clinical study, the combination of obinutuzumab (in combination with chlorambucil) improved the progression-free survival (PFS) of patients to 23.0 months compared to 11.1 months for chlorambucil alone.







Obinutuzumab (CHEMBL1743048) is a humanized anti-CD20 monoclonal antibody of ca. 150 kDa molecular weight. Its target, the B-lymphicyte antigen CD20, is the product of the gene MS4A1 (Uniprot: P11836; ChEMBL: CHEMBL2058; canSAR target synopsis. The CD20 antigen is expressed on the surface of pre B- and mature B-lymphocytes. Obinutuzumab mediates B-cell lysis through three main routes:


  • Engagement of immune effector cells, resulting in antibody-dependent cellular cytotoxicity and antibody-dependent cellular phagocytosis


  • Direct activation of intracellular death signaling pathways


  • Activation of the complement cascade.



>obinutuzumab
QVQLVQSGAEVKKPGSSVKVSCKASGYAFSYSWINWVRQAPGQGLEWMGR 

IFPGDGDTDYNGKFKGRVTITADKSTSTAYMELSSLRSEDTAVYYCARNV 

FDGYWLVYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD 

YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTY 

ICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK 

DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS 

TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV 

YTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL 

DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK/

DIVMTQTPLSLPVTPGEPASISCRSSKSLLHSNGITYLYWYLQKPGQSPQ 

LLIYQMSNLVSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCAQNLELP 

YTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAK 

VQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE 

VTHQGLSSPVTKSFNRGEC




The geometric mean (CV%) volume of distribution of obinutuzumab at steady state is approximately 3.8L. The terminal clearance is 0.09 (46%) L/day and the terminal half-life is ~28.4 days.



Obinutuzumab has been issued with a boxed warning because of the following observed events: Reactivation of Hepatitis B Virus (HBV), in some cases resulting in fulminant hepatitis, hepatic failure, and death; and causing Progressive Multifocal Leukoencephalopathy (PML) resulting in death.



GazyvaTM is produced by Genentech, Inc.
The full Prescribing Information is here.


New ChEMBL-NTD Depositions







We are very pleased to announce the release of two new datasets on the ChEMBL-NTD portal.



The first dataset is provided by the Drug for Neglected Diseases initiative (DNDi) and is focused on the selection and optimization of hits from a high-throughput phenotypic screen against Trypanosoma cruzi. The paper describing the dataset in more detail can be accessed here and the data can be downloaded from here.

 

The second dataset from the DeRisi Lab UCSF and is focused on the screening of MMVs Malaria Box compounds in Plasmodium falciparum, to understand if anti-malarial compounds target the apicoplast organelle. More details about the dataset can be found here and the data can be downloaded from here.  



Both datasets will be loaded into the next version of ChEMBL, which will be due out early next year.



The ChEMBL - Neglected Tropical Disease portal is a repository for Open Access primary screening and medicinal chemistry data directed at neglected diseases. If you would like to deposit your data here please get in contact.



The ChEMBL Team

Tuesday, 12 November 2013

RDKit and Raphael.js







The ChEMBL group had the honour of hosting the second RDKit UGM. It was a great way to catch up with the RDKit community, find out about what they are working and learn about new features the toolkit offers. We gave two talks during the meeting, so if you want to know how Clippy can make interacting with different chemical formats on your desktop easier, go here, and if you want to learn about wrapping RDKit up in a RESTful Web Service a.k.a. Beaker (to be described in future blog post), go here. Many discussions about new features RDKit could offer were had throughout the meeting and one which caught my attention was support for plotting compound images on HTML5 Canvas.



Unable to participate in a hackathon held on the final day, I set about hosting my own small hackathon during the weekend (only 1 attendee). The result of this weekend coding effect was a pull request made against RDKit github repo, introducing the new class called JSONCanvas.



Technical Details



As a general rule of the past, the model for generating image relies on
the server to sending a binary representation of the compound (e.g.
.png, .jpeg) to the client. With advances in browser technologies, it is
now feasible to rely on the client to generate the graphical
representation of the compound as it now has access to many methods,
which allows it to handle geometrical primitives. It can decide if those primitives should be rendered as SVG, VML or even HTML5 Canvas (check out  Kinetic.js for HTML5 canvas rendering, as it knows how to draw some core shapes on canvas). 



My solution uses Raphael.js - a JavaScript library for drawing vector graphics in the browser. For displaying the graphic is uses SVG on browsers that support this format. On older browsers it will fail over to VML. In the library documentation we can find a very interesting method called Paper.add(). This method accepts JSON containing an array of geometrical objects (such as circle, rectangle, path) to be displayed and returns a handle for manipulating (moving, rotating, scaling) the object as a whole. This means that if we could create a JSON object, which uses shapes to represent a chemical compound, we could draw it or manipulate the compound directly. The new JSONCanvas class produces the previously described JSON object for any* given RDKit compound.



(*I am sure we might find a couple of exceptions)



But why?



1. Cost - reduced server processing required to raster image and often third-party drawing libraries are also required.



2. Bandwidth - reduced bandwidth required to transfer JSON representation of compounds. Also, as it  is text-based you can employ further compression (by configuring your server to send gziped JSON which most modern browsers understand) or using AMF.



3. Accuracy - improved scaling quality made possible with vector graphics.



4. Interactivity - compounds rendered using JSON on the client side can handle standard events such as click, hover, etc. Complex operations (animating, sorting, dragging,...), can also be applied to these objects.



Usage



As an example usage of this technique please look at our chemical game. To give you some idea of scale and performance the game loads 1000 compounds when page first loads. If you want to see raw example please explore source of my demo page. Other examples can involve:



1.  Online compound cloud (similar to tag cloud but with compound images instead of words). Such a cloud can be used to visualise compound similarity.



2. Compound stream - substructure search can sometimes return very large number of results. Such results can be represented as pseudo-infinite stream of compounds - only small portion of results is presented on the screen but scrolling down causes more results to be rendered when older one are discarded.



How can I use it?



1. You can download my fork or RDKit containing all relevant changes.



2. Today Greg Landrum, RDKit creator made his own branch containing modified version of the original pull request, so hopefully this is on it's way to be accepted in master branch in future.



As a group we are happy to participate in such a great open source library!



--

MichaƂ

Sunday, 10 November 2013

USAN Watch: September 2013








The USANs for September, 2013 have recently been published. We actually missed September, due to switch over in service for the INNs, but now they're here.





















































































































































































USAN Research Code InChIKey (Parent) Drug Class Therapeutic class Target
aducanumab BIIB-037 n/a monoclonal antibody therapeutic beta amyloid
aptorsen-sodium OGX-427 n/a oligonucleotide therapeutic HSP27
asfotase-alfa ALXN-1215, ENB-0040 n/a enzyme therapeutic n/a
batefenterolbatefenterol-succinate GSK-961081A URWYQGVSPQJGGB-DHUJRADRSA-N synthetic small molecule therapeutic Muscarinic receptors, B2 receptor
bococizumab RN-316, PF-04950615 n/a monoclonal antibody therapeutic PC9
dactolisibdactolisib-tosylate NVP-BEZ235-NX








JOGKUKXHTYWRGZ-UHFFFAOYSA-N synthetic small molecule therapeutic MTOR, PI3K
deldeprevirdeldeprevir-sodium ACH-0142684, ACH-2684 UDMJANYPQWEDFT-ZAWFUYGJSA-N synthetic small molecule therapeutic HCV NS3 PR
etiguanfacine SSP-1871 NWKJFUNUXVXYGE-UHFFFAOYSA-N synthetic small molecule therapeutic
faldaprevirfaldaprevir-sodium BI-201335
synthetic small molecule therapeutic HCV NS3 PR
fedratinib SAR-302503; TG-101348 JOOXLOJCABQBSG-UHFFFAOYSA-N synthetic small molecule therapeutic FLT3, JAK2
grazoprevir n/a n/a synthetic small molecule therapeutic
irinotecan-sucrosofate MM-398, PEP-02 n/a natural product derived small molecule therapeutic topo 1
luspatercept ACE-536 n/a protein therapeutic TGF-B family
mavoglurant AFQ-056 ZFPZEYHRWGMJCV-ZHALLVOQSA-N synthetic small molecule therapeutic mGluR5
otlertuzumab TRU-016 n/a monoclonal antibody therapeutic CD37
ralpancizumab RN317, PF-05335810 n/a monoclonal antibody therapeutic PC9
romyelocel-l CLT-008 n/a cellular therapy therapeutic n/a
roxadustat FG-4592; ASP-1517 YOZBGTLTNGAVFU-UHFFFAOYSA-N synthetic small molecule therapeutic prolyl hydoxylase
simtuzumab AB-0024; GS-6624 n/a monoclonal antibody therapeutic LOXL2
sucroferric-oxyhydroxide PA-21 n/a inorganic sequestering agent n/a
tecemotide BLP-25 n/a peptide vaccine peptide vaccine n/a


Friday, 8 November 2013

Paper: The ChEMBL bioactivity database: an update



An update to what has happen to the Wellcome Trust funded database ChEMBL over the past few years has just been published - it seems odd, that we've been around long enough to achieve our 2nd NAR Database paper - so much more to do though! This paper contains features and content up to ChEMBL 17.



This could put you in a difficult position which NAR paper to cite in your own publications using ChEMBL; so we suggest both! ;)



Oh, and it's Open Access, of course.



%J Nucleic Acids Research
%D 2013
%P 1–8
%O doi:10.1093/nar/gkt1031
%T The ChEMBL bioactivity database: an update
%A A.P. Bento
%A A. Gaulton
%A Anne Hersey
%A L.J. Bellis,
%A J. Chambers
%A M. Davies
%A F.A. Krueger
%A Y. Light
%A L. Mak
%A S. McGlinchey
%A M. Nowotka
%A G. Papadatos
%A R. Santos
%A J.P. Overington



jpo